PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G55020.1
Common NameATMYB120, MYB120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 523aa    MW: 58217.4 Da    PI: 10.0037
Description myb domain protein 120
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G55020.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.3e-152875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ede+l+ +v++ G g+W+++ +  g+ R++k+c++rw ++l
      AT5G55020.1 28 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 75
                     79******************************************9986 PP

2Myb_DNA-binding46.58.7e-1581124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T +E+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
      AT5G55020.1  81 KGSFTGDEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 124
                      789*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3172375IPR017930Myb domain
SMARTSM007171.6E-122777IPR001005SANT/Myb domain
SuperFamilySSF466895.35E-2827122IPR009057Homeodomain-like
PfamPF002492.3E-142875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-212982IPR009057Homeodomain-like
CDDcd001673.17E-103075No hitNo description
PROSITE profilePS5129424.41376130IPR017930Myb domain
SMARTSM007172.5E-1580128IPR001005SANT/Myb domain
PfamPF002491.7E-1381124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2483128IPR009057Homeodomain-like
CDDcd001678.02E-1183126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009860Biological Processpollen tube growth
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025195anatomypollen tube cell
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MIMYGGGGAG KDGGSTNHLS DGGVILKKGP WTAAEDEILA AYVRENGEGN WNAVQKNTGL  60
ARCGKSCRLR WANHLRPNLK KGSFTGDEER LIIQLHAQLG NKWARMAAQL PGRTDNEIKN  120
YWNTRLKRLL RQGLPLYPPD IIPNHQLHPH PHHQQQQQHN HHHHHHQQQQ QHQQMYFQPQ  180
SSQRNTPSSS PLPSPTPANA KSSSSFTFHT TTANLLHPLS PHTPNTPSQL SSTPPPPPLS  240
SPLCSPRNNQ YPTLPLFALP RSQINNNNNG NFTFPRPPPL LQPPSSLFAK RYNNANTPLN  300
CINRVSTAPF SPVSRDSYTS FLTLPYPSPT AQTATYHNTN NPYSSSPSFS LNPSSSSYPT  360
STSSPSFLHS HYTPSSTSFH TNPVYSMKQE QLPSNQIPQI DGFNNVNNFT DNERQNHNLN  420
SSGAHRRSSS CSLLEDVFEE AEALASGGRG RPPKRRQLTA SLPNHNNNTN NNDNFFSVSF  480
GHYDSSDNLC SLQGKTKTTY NTSNLNYSSL QVKCKMFMIK TQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29261285106B-MYB
1mse_C4e-29251281103C-Myb DNA-Binding Domain
1msf_C4e-29251281103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1450455RPPKRR
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248116_at0.0
Expression AtlasAT5G55020-
AtGenExpressAT5G55020-
ATTED-IIAT5G55020-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor, member of the R2R3 factor gene family (MYB120).
Function -- GeneRIF ? help Back to Top
  1. All these results indicate that MYB97, MYB101 and MYB120 participate in pollen tube reception, possibly by controlling the expression of downstream genes.
    [PMID: 24278028]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G55020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G55020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719790.0AF371979.1 Arabidopsis thaliana putative transcription factor MYB120 (MYB120) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568819.10.0myb domain protein 120
TrEMBLQ94FL70.0Q94FL7_ARATH; Myb domain protein 120
STRINGAT5G55020.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Okada T,Bhalla PL,Singh MB
    Expressed sequence tag analysis of Lilium longiflorum generative cells.
    Plant Cell Physiol., 2006. 47(6): p. 698-705
    [PMID:16571618]
  4. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  5. Qin Y, et al.
    Penetration of the stigma and style elicits a novel transcriptome in pollen tubes, pointing to genes critical for growth in a pistil.
    PLoS Genet., 2009. 5(8): p. e1000621
    [PMID:19714218]
  6. Leydon AR, et al.
    Three MYB transcription factors control pollen tube differentiation required for sperm release.
    Curr. Biol., 2013. 23(13): p. 1209-14
    [PMID:23791732]
  7. Liang Y, et al.
    MYB97, MYB101 and MYB120 function as male factors that control pollen tube-synergid interaction in Arabidopsis thaliana fertilization.
    PLoS Genet., 2013. 9(11): p. e1003933
    [PMID:24278028]